DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exex and hoxd3

DIOPT Version :9

Sequence 1:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_002935734.1 Gene:hoxd3 / 100038058 XenbaseID:XB-GENE-478462 Length:415 Species:Xenopus tropicalis


Alignment Length:329 Identity:77/329 - (23%)
Similarity:118/329 - (35%) Gaps:151/329 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 PSGAAAPPPVSPQPAA----NHLSH--SGATMATTTLLPPAQSQPKKSFCIDALLAKSQHQSGEP 237
            ||.|.     |.||||    ||.::  ||:.|.||:.....|:..         ::..|||:...
 Frog    59 PSTAC-----SIQPAAIRAPNHKANDISGSCMRTTSSQNSNQAPS---------ISNQQHQAPSL 109

  Fly   238 QPIIVDDRLAALHYARDQAELNHAFVTASNAAAAAQAAASAAGGISEQEALQRIRDSREYDSPSP 302
            .|                :..:|...:|...:.::.::.|:...:|:| ....:::||:      
 Frog   110 PP----------------SSPSHGNSSAQKKSKSSNSSGSSQATLSKQ-IFPWMKESRQ------ 151

  Fly   303 DGMSRSESPTSSHRSSPPISPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRPQDFP 367
               :..:..|||..|:|| ...||::.                                      
 Frog   152 ---NAKQKNTSSSSSTPP-GENCEEKS-------------------------------------- 174

  Fly   368 LYAGGHPYQLLAQGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPELAAYPH 432
                                |..||.|                                      
 Frog   175 --------------------PTGPSSK-------------------------------------- 181

  Fly   433 HAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRS 497
                    |.|||:||.||:||||:|..|:||.||:|.|:|:.|.|:|.|:||||||||||:|:.
 Frog   182 --------RVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKD 238

  Fly   498 KKAQ 501
            :||:
 Frog   239 QKAK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 34/52 (65%)
hoxd3XP_002935734.1 Homeobox 184..237 CDD:365835 34/52 (65%)
DUF4074 352..413 CDD:372548
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.