DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Srp9 and AT3G49100

DIOPT Version :9

Sequence 1:	NP_648163.1	Gene:	Srp9 / 38883	FlyBaseID:	FBgn0035827	Length:	77	Species:	Drosophila melanogaster
Sequence 2:	NP_001327913.1	Gene:	AT3G49100 / 824071	AraportID:	AT3G49100	Length:	103	Species:	Arabidopsis thaliana

Alignment Length:	67	Identity:	23/67 - (34%)
Similarity:	45/67 - (67%)	Gaps:	0/67 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MVFVKNWDDFEIAVENMYLANPQNCRLTMKYAHSKGHILLKMTDNVKCVQYKAENMPDLRKIEKI 65
            ||::.:||:|......::.|:|::.|..|||.|..|.::||:|||.:|:::|.:...:.:|:||:
plant     1 MVYIASWDEFVDRSVQLFRADPESTRYVMKYRHCDGKLVLKVTDNKECLKFKTDQAQEAKKMEKL 65

  Fly    66 TS 67
            .:
plant    66 NN 67

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Srp9	NP_648163.1	SRP9-21	4..73	CDD:283207	21/64 (33%)
AT3G49100	NP_001327913.1	SRP9-21	4..67	CDD:398894	21/62 (34%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	56	1.000	Domainoid score	I4081
eggNOG	1	0.900	-	-		E1_KOG3465
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	62	1.000	Inparanoid score	I2536
OMA	1	1.010	-	-		QHG54656
OrthoDB	1	1.010	-	-		D1623953at2759
OrthoFinder	1	1.000	-	-		FOG0006630
OrthoInspector	1	1.000	-	-		oto3210
orthoMCL	1	0.900	-	-		OOG6_104467
Panther	1	1.100	-	-	LDO	PTHR12834
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X4865
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
	13	12.840