DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp9 and Srp9

DIOPT Version :9

Sequence 1:NP_648163.1 Gene:Srp9 / 38883 FlyBaseID:FBgn0035827 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001119567.1 Gene:Srp9 / 690345 RGDID:1597343 Length:86 Species:Rattus norvegicus


Alignment Length:73 Identity:28/73 - (38%)
Similarity:48/73 - (65%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KNWDDFEIAVENMYLANPQNCRLTMKYAHSKGHILLKMTDNVKCVQYKAENMPDLRKIEKITSNL 69
            :.|::|..|.|.:|||:|...|:.:||.|..|::.:|:||::.|:.|:.:...|::||||..|.|
  Rat     5 QTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKFHSQL 69

  Fly    70 VGHMASKE 77
            :..|.:||
  Rat    70 MRLMVAKE 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp9NP_648163.1 SRP9-21 4..73 CDD:283207 25/67 (37%)
Srp9NP_001119567.1 SRP9-21 4..73 CDD:398894 25/67 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353250
Domainoid 1 1.000 64 1.000 Domainoid score I9939
eggNOG 1 0.900 - - E1_KOG3465
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5231
OMA 1 1.010 - - QHG54656
OrthoDB 1 1.010 - - D1623953at2759
OrthoFinder 1 1.000 - - FOG0006630
OrthoInspector 1 1.000 - - oto98876
orthoMCL 1 0.900 - - OOG6_104467
Panther 1 1.100 - - LDO PTHR12834
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4865
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.