DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp9 and SRP9

DIOPT Version :9

Sequence 1:NP_648163.1 Gene:Srp9 / 38883 FlyBaseID:FBgn0035827 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_003124.1 Gene:SRP9 / 6726 HGNCID:11304 Length:86 Species:Homo sapiens


Alignment Length:73 Identity:30/73 - (41%)
Similarity:49/73 - (67%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KNWDDFEIAVENMYLANPQNCRLTMKYAHSKGHILLKMTDNVKCVQYKAENMPDLRKIEKITSNL 69
            :.|::|..|.|.:|||:|...|:.:||.||.|::.:|:||::.|:.||.:...|::||||..|.|
Human     5 QTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQL 69

  Fly    70 VGHMASKE 77
            :..|.:||
Human    70 MRLMVAKE 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp9NP_648163.1 SRP9-21 4..73 CDD:283207 27/67 (40%)
SRP9NP_003124.1 SRP9-21 4..73 CDD:398894 27/67 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159229
Domainoid 1 1.000 68 1.000 Domainoid score I9767
eggNOG 1 0.900 - - E1_KOG3465
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5308
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54656
OrthoDB 1 1.010 - - D1623953at2759
OrthoFinder 1 1.000 - - FOG0006630
OrthoInspector 1 1.000 - - oto91813
orthoMCL 1 0.900 - - OOG6_104467
Panther 1 1.100 - - LDO PTHR12834
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2816
SonicParanoid 1 1.000 - - X4865
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.