DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp9 and Srp9

DIOPT Version :10

Sequence 1:NP_648163.1 Gene:Srp9 / 38883 FlyBaseID:FBgn0035827 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_036188.1 Gene:Srp9 / 27058 MGIID:1350930 Length:86 Species:Mus musculus


Alignment Length:73 Identity:28/73 - (38%)
Similarity:48/73 - (65%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KNWDDFEIAVENMYLANPQNCRLTMKYAHSKGHILLKMTDNVKCVQYKAENMPDLRKIEKITSNL 69
            :.|::|..|.|.:|||:|...|:.:||.|..|::.:|:||::.|:.|:.:...|::||||..|.|
Mouse     5 QTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKFHSQL 69

  Fly    70 VGHMASKE 77
            :..|.:||
Mouse    70 MRLMVAKE 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp9NP_648163.1 SRP9-21 4..73 CDD:428490 25/67 (37%)
Srp9NP_036188.1 SRP9-21 4..73 CDD:428490 25/67 (37%)

Return to query results.
Submit another query.