DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp9 and SPAC17H9.07

DIOPT Version :9

Sequence 1:NP_648163.1 Gene:Srp9 / 38883 FlyBaseID:FBgn0035827 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001342841.1 Gene:SPAC17H9.07 / 2542449 PomBaseID:SPAC17H9.07 Length:120 Species:Schizosaccharomyces pombe


Alignment Length:74 Identity:15/74 - (20%)
Similarity:41/74 - (55%) Gaps:5/74 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFVKNWDDFEIAVENMYLANPQNCRLTMKY---AHSKGHILLKMTDNVK--CVQYKAENMPDLR 60
            ||:::..::|....:::..|.|:..:|::||   ..|:.:::.|..::..  |::|:.:...:|.
pombe     1 MVYLQTVNEFFTQSKSLTEAYPKTTKLSIKYRTNEQSQNYLIAKAFESASGICLKYRTDKAAELG 65

  Fly    61 KIEKITSNL 69
            ::..|.:.|
pombe    66 RLLLIANKL 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp9NP_648163.1 SRP9-21 4..73 CDD:283207 13/71 (18%)
SPAC17H9.07NP_001342841.1 SRP9-21 4..74 CDD:310233 12/69 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12834
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.