DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp9 and ZK512.4

DIOPT Version :9

Sequence 1:NP_648163.1 Gene:Srp9 / 38883 FlyBaseID:FBgn0035827 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_499026.1 Gene:ZK512.4 / 176293 WormBaseID:WBGene00013984 Length:76 Species:Caenorhabditis elegans


Alignment Length:70 Identity:30/70 - (42%)
Similarity:49/70 - (70%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFVKNWDDFEIAVENMYLANPQNCRLTMKYAHSKGHILLKMTDNVKCVQYKAENMPDLRKIEKI 65
            |.:..:||:|..|.|.::.|||:.||...||.|:||.::||:||:|.|:||....:.|::|:||:
 Worm     1 MTYFTSWDEFAKAAERLHSANPEKCRFVTKYNHTKGQLVLKLTDDVVCLQYSTNQLQDVKKLEKL 65

  Fly    66 TSNLV 70
            :|.|:
 Worm    66 SSTLL 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp9NP_648163.1 SRP9-21 4..73 CDD:283207 29/67 (43%)
ZK512.4NP_499026.1 SRP9-21 4..73 CDD:283207 29/67 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166798
Domainoid 1 1.000 76 1.000 Domainoid score I5847
eggNOG 1 0.900 - - E1_KOG3465
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3820
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54656
OrthoDB 1 1.010 - - D1623953at2759
OrthoFinder 1 1.000 - - FOG0006630
OrthoInspector 1 1.000 - - oto18429
orthoMCL 1 0.900 - - OOG6_104467
Panther 1 1.100 - - LDO PTHR12834
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2816
SonicParanoid 1 1.000 - - X4865
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.