DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8111 and tmem43

DIOPT Version :9

Sequence 1:NP_648162.2 Gene:CG8111 / 38881 FlyBaseID:FBgn0035825 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_998403.1 Gene:tmem43 / 406520 ZFINID:ZDB-GENE-040426-2348 Length:282 Species:Danio rerio


Alignment Length:285 Identity:88/285 - (30%)
Similarity:135/285 - (47%) Gaps:56/285 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 MYQWVE----EAVEHNYGDSVGTTHSDSRTYYYTREWRDKIVDSRNFYNRHGHTNPSHFPIESHV 161
            ||||||    ..||.| |:....|     ||.|..|||.:::.||:|....||.|||...:||..
Zfish     1 MYQWVEYSDSRTVEEN-GEKKTET-----TYSYNTEWRSEVISSRHFDQEVGHMNPSEMAVESVT 59

  Fly   162 QVADAVFIGRYELGAEVKEKFNNYQELTSDIRP---------EDSGVKLHLGIYYHTNDVFNPEV 217
            .||..|::|.:.|...:.|:.:.:..|:....|         :|.       .||||.:..:|||
Zfish    60 VVAPEVWVGNFLLSTGLVEQISEFHTLSLSALPVPVAGFLTVQDD-------YYYHTPNPQHPEV 117

  Fly   218 GDLRLLFSFAGMEGE--------VFSVVGKLSGNKLVPYITSRGVPVLLVYPGGLSVQEVFRLEA 274
            ||:|:.|::||:.|:        ..|||.:....:|.|:.:..|..:.|:|.|.|:.:|:|..|.
Zfish   118 GDVRVRFAYAGLSGDGLYPGSAHKVSVVAQQHQQQLRPFSSRSGHTLELLYMGQLTAEELFAKEH 182

  Fly   275 RAQVLHTWWWRFVGWLLIFFGVTCNTKILRLLFVRVPLLVALAPDPQFPVTGNLL---------- 329
            :...:.||..|..|..|:|..::.:|:::..|..|||||            |.||          
Zfish   183 QLNSMKTWALRLAGCTLMFLSISLSTRVIHTLVERVPLL------------GGLLSVGLQLFCLC 235

  Fly   330 IAFSLALTIAAVAWILHRPVIGACL 354
            .:.||:|...|..||.:||::..|:
Zfish   236 SSVSLSLLTIAAGWIYYRPLLALCV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8111NP_648162.2 DUF1625 102..348 CDD:285081 84/276 (30%)
tmem43NP_998403.1 DUF1625 2..254 CDD:285081 84/276 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11532
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D548440at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.