DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8281 and CG3163

DIOPT Version :9

Sequence 1:NP_648161.1 Gene:CG8281 / 38880 FlyBaseID:FBgn0035824 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_611872.1 Gene:CG3163 / 37836 FlyBaseID:FBgn0034961 Length:368 Species:Drosophila melanogaster


Alignment Length:337 Identity:77/337 - (22%)
Similarity:126/337 - (37%) Gaps:83/337 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YLRAFIQTYRDLPVLWDTSLRDYTNREKRAEAYLRLVPIYHYLKRDATVEDVKKKINTLRTNYRK 86
            ::..||:.|:..|.||.....|:.||.:|.|||.:|:.:.........||..|:|||.||..:|.
  Fly     3 FIDDFIEEYKSNPCLWKADSADFRNRSRRQEAYAKLIEVATKHGEMYNVERTKQKINNLRCAFRH 67

  Fly    87 ELKVVESALRSGSLHSPRC---WTFQELDFLRNSEKFLAVNPAFKNEPNFAFGESSNCPSAFLES 148
            :|:......:.|..:.|.|   ..|:.|.||::.|  :..:..||.|.:.....|          
  Fly    68 QLRKYNEVKKKGEKYEPYCPKRRYFESLMFLKDEE--IPADKKFKREQSVCLDNS---------- 120

  Fly   149 QGAALHYPAPRAGGQTPNISEMFHKSFGAPPPPPPATNHVDYGSSKRARQTPPCTG----AGAGS 209
                :...||..|.:..: :|..||      ||.|..:.:....:..|.:.  |..    |.|.:
  Fly   121 ----MQLGAPENGDEYSD-AESLHK------PPKPTADSIKMSPNNSANEF--CANIFEEAAAAA 172

  Fly   210 TGGPGATGTAHNTDELLNIACEYLAGTYPEEESIARTWTHKLKRLPREQRLLAER------FINE 268
            ...|..      :.:.:|.|..:.:|...:|..|.         :|...|||:.|      .|..
  Fly   173 AADPVI------SIKTVNNANSHASGATIKEVEIV---------VPANNRLLSARRKSVPDSIKS 222

  Fly   269 ILFEAESNNLHRGSVQ-----INNSFEPYVRYEETPN---GHEEQDKSQSPSVHTSSESKPNVSG 325
            ...::||....|...|     |:|         ::|:   .|..:.:|.|.|...|.:::|    
  Fly   223 PPGDSESPQCKRIVTQNQTKLISN---------QSPSQKANHITRKRSSSVSSQISEDNEP---- 274

  Fly   326 ASGSGGGGGPPG 337
                     |||
  Fly   275 ---------PPG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8281NP_648161.1 MADF_DNA_bdg 26..114 CDD:287510 29/90 (32%)
CG3163NP_611872.1 MADF_DNA_bdg 7..98 CDD:287510 29/90 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468900
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CAYR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.