DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8281 and CG10904

DIOPT Version :9

Sequence 1:NP_648161.1 Gene:CG8281 / 38880 FlyBaseID:FBgn0035824 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001286800.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster


Alignment Length:213 Identity:52/213 - (24%)
Similarity:77/213 - (36%) Gaps:47/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RHYLRAFIQTYRDLPVLWDTSLRDYTNREKRAEAYLRLVPIYHYLKRDATVEDVKKKINTLRTNY 84
            |..:...|:.||....||:.....|.|::.||:|...:.     ...:.|..|..||::.||..:
  Fly    26 REKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESIC-----ASLEITKHDYGKKVHNLRNQF 85

  Fly    85 RKELKVVESALR--SGSLHSPRC--WT-FQELDFLRNSEKFLAVNPAFKNEPNFAFGESSN---- 140
            ..|||.:|..|.  .|...|.:.  |. |:.|.|||:     .:.|    .|.:..|....    
  Fly    86 NAELKKLERRLEESGGDRDSEKACRWEHFKTLMFLRS-----VIEP----RPGYQQGAPGKKLVS 141

  Fly   141 ----C-PSAFLESQGAA---------LHYPAPRAGGQTPNISEMFHKSFGAPPPPPPATNHVDYG 191
                | |...:|.|..:         :...|...  |.|.:||....   .||.|.|::..||..
  Fly   142 KLDMCYPDQDVEKQSQSSIESLESMIIENDAEIC--QPPKVSEPIPP---MPPEPAPSSKFVDPN 201

  Fly   192 SSKRARQTP-----PCTG 204
            .:..|...|     |.:|
  Fly   202 RTVEAPAAPSPFHLPLSG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8281NP_648161.1 MADF_DNA_bdg 26..114 CDD:287510 26/92 (28%)
CG10904NP_001286800.1 MADF 31..125 CDD:214738 29/103 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468903
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.