DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8281 and CG33017

DIOPT Version :10

Sequence 1:NP_648161.1 Gene:CG8281 / 38880 FlyBaseID:FBgn0035824 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_788375.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster


Alignment Length:176 Identity:41/176 - (23%)
Similarity:64/176 - (36%) Gaps:57/176 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IQTYRDLPVLWDTSLRDYTNREKRAEAYLRLVPIYHYLKRDATVEDVKKKINTLRTNYRKELKVV 91
            |:.||....||:.....:.:...:.:|:.:   |...:....|.:.|:.::..||..|.|||..:
  Fly    22 IRLYRSNECLWNPKSPGFHSGSAKDDAWRQ---ITRRMNCGLTPDQVELQVLGLRHYYSKELAAI 83

  Fly    92 ESALRSGSLHSPRCWTFQELDFLRNSEKFLAVNPAFKNEPNFAFGESSNCPSAFLESQGAALHYP 156
            .::...|..:|||...|::|.||.|.|                  |.:|||.    .:|   |:|
  Fly    84 RNSQIEGYSYSPRYSYFEDLHFLGNLE------------------EEANCPI----KEG---HFP 123

  Fly   157 APRAGGQTPNISE---------------------MFHKSFGAPPPP 181
                    ||.||                     .|:|....|.||
  Fly   124 --------PNFSEDTFISPLAFLSPSCSETRCGYTFYKMILEPEPP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8281NP_648161.1 MADF_DNA_bdg 26..114 CDD:463144 21/86 (24%)
CG33017NP_788375.1 MADF_DNA_bdg 21..106 CDD:463144 21/86 (24%)
PTZ00108 <580..830 CDD:240271
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.