DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8281 and CG15601

DIOPT Version :9

Sequence 1:NP_648161.1 Gene:CG8281 / 38880 FlyBaseID:FBgn0035824 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster


Alignment Length:326 Identity:79/326 - (24%)
Similarity:117/326 - (35%) Gaps:98/326 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MSGAEENRHYLRAFIQTYRDLPVLWDTSLRDYTNREKRAEAY---LRLVPIYHYLKRDATVEDVK 74
            ||...:.:..:..|::.||..|.|::|.|..|.||..|.|||   :|.:.|     ...||.|:|
  Fly     1 MSKLSDTKIPITEFLEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIRSLKI-----PQLTVSDIK 60

  Fly    75 KKINTLRTNYRKELKVVESALRSGSLHSPRCWTFQELD-FLRN---------------------- 116
            .||.::||.|.|||::.......|..:.|:.:.|:..| |||:                      
  Fly    61 LKIKSVRTVYSKELRIWMREKELGRTYEPKLFWFRLADSFLRSVSLSHCKRQGKNNSSSAQLTTI 125

  Fly   117 ----SEKFLAV--------NPAFKNEPNFAFGESSNCPSAFLESQGAALHYPAPRAG----GQTP 165
                :.|.|..        ..|.:.|.....||...||          |....|.|.    ..|.
  Fly   126 KSDETSKLLCTAAADITMSEDALEEEDAEVNGEPEECP----------LEESRPTASICKDDSTL 180

  Fly   166 NISEMFHKSFGAPPPPPPATNHVDYGSSKRARQTPPCTGAGAGS---TGGPGATGTAHNTDELLN 227
            .:::.            |...|...|.|  :.|..|.|.|...|   |....|     ..|:|:.
  Fly   181 CLADQ------------PQQEHYSQGCS--SSQQLPHTMAQRKSKYITSLDSA-----GEDDLII 226

  Fly   228 IACEYLAGTYPEEESIARTWTHKLKRLPRE-QRLLAERFINEILFEAESNNLHR---GSVQINNS 288
            ..           :|||    .:|:.:|.. .|.:|:..|.::|||||:.....   .|.|:.|:
  Fly   227 FG-----------QSIA----SQLRTIPDSYSRSVAKLRIQQVLFEAETGQFQSTEVNSTQLQNT 276

  Fly   289 F 289
            |
  Fly   277 F 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8281NP_648161.1 MADF_DNA_bdg 26..114 CDD:287510 32/91 (35%)
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:287510 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.