DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8281 and LOC101734835

DIOPT Version :9

Sequence 1:NP_648161.1 Gene:CG8281 / 38880 FlyBaseID:FBgn0035824 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_004919755.2 Gene:LOC101734835 / 101734835 -ID:- Length:298 Species:Xenopus tropicalis


Alignment Length:290 Identity:81/290 - (27%)
Similarity:119/290 - (41%) Gaps:75/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NRHYLRAFIQTYRDLPVLWDTSLRDYTNREKRAEAYLRLVPIYHYLKRDATVEDVKKKINTLRTN 83
            |..:||.||:.|:..|.||.....||.||.||.:||..|:.:...:...|.|:.||.||..|||.
 Frog    27 NPEFLRKFIEMYQSFPCLWKVKSGDYMNRIKRDKAYAELISLCKSVCSSADVQFVKTKIANLRTV 91

  Fly    84 YRKELKVVESALRSGS----LHSPRCWTFQELDFLRNSEKFLAVNPAFKNEPNFAFGESSNCPSA 144
            ::|||..|:::.:||:    ::.|:.|.:..|.|..:.|              .|....||..|.
 Frog    92 FKKELNKVQASKKSGASADDIYLPKLWYYDLLVFTVDQE--------------VARDSRSNFSSQ 142

  Fly   145 FLESQGAALHYPA----------PRAG-----GQTPNISEMFHKSFGAPPPPPPATNHVDYGSSK 194
            .:|.|.:....||          .||.     .||.:::::           |.::..::.||..
 Frog   143 GVEKQQSTEASPAEDVTDVEAQSSRAADIEVEDQTEHLAQI-----------PQSSTLIEEGSQH 196

  Fly   195 RARQTPPCTGAGAGSTGG--------PGATGTAHNTDELLNIACEYLAGTYPEEESIARTWTHKL 251
            ..        |||..|.|        |......|:.:.|||...:       |.::|..|...||
 Frog   197 EM--------AGAKGTQGRNRKRKHNPSTQQLLHDAEALLNRKSD-------EFDAIGFTVASKL 246

  Fly   252 KRLPREQRLLAERFINEILFEAESNNLHRG 281
            :|:..|||..||..|||.        ||||
 Frog   247 RRMDEEQRQFAEYIINEA--------LHRG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8281NP_648161.1 MADF_DNA_bdg 26..114 CDD:287510 33/91 (36%)
LOC101734835XP_004919755.2 MADF_DNA_bdg 34..125 CDD:287510 33/90 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1381134at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.