DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8281 and XB5795725

DIOPT Version :9

Sequence 1:NP_648161.1 Gene:CG8281 / 38880 FlyBaseID:FBgn0035824 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_017945019.1 Gene:XB5795725 / 100495603 XenbaseID:XB-GENE-5795726 Length:341 Species:Xenopus tropicalis


Alignment Length:294 Identity:79/294 - (26%)
Similarity:123/294 - (41%) Gaps:70/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YLRAFIQTYRDLPVLWDTSLRDYTNREKRAEAYLRLVPIYHYLKRDATVEDVKKKINTLRTNYRK 86
            :|:.||:.||.||.||.....||.|::|:..||.:||.:...:...|.:|.||.||..|||.::|
 Frog    89 FLKEFIEMYRALPCLWKVKSTDYFNKQKKNRAYEKLVRLCKSVCPTANLEYVKHKIANLRTVFKK 153

  Fly    87 ELKVVESALRSG----SLHSPRCWTFQELDFLRNSEKFLAVNPAFKNEPNFAFGESSN---C--- 141
            |||.||.:.|||    :::.||.|.|:.|.|....:   |...|..|     .|||.:   |   
 Frog   154 ELKKVELSKRSGATGDNVYVPRLWYFELLKFTIEQD---ASGNATSN-----LGESEDIIPCDVG 210

  Fly   142 -------PSAFLESQGAALHYPAPRAGGQTPNISEMFHKSFGAPPPPPPATNHVDYGSSKRARQT 199
                   ..:|:|..             ::||:|:|   |...|.......:..::...|:..:.
 Frog   211 EEEKRASEESFVEIV-------------ESPNLSQM---SIHRPNEAAMENDAEEFSLPKKQMKR 259

  Fly   200 PPCTGAGAGSTGGPGATGTAHNTD---ELLNIACEYLAGTYPEEESIARTWTHKLKRLPREQRLL 261
            ..|                  |.|   :||:.|...|:....|.::.......||:::...|||.
 Frog   260 KLC------------------NDDLEKQLLSQAAAILSRDDDEYDNFGVIVASKLRKMDENQRLA 306

  Fly   262 AERFINEILFEAESNNLHRGSVQINNSFEPYVRY 295
            ||..|.::        ||:|.::..|..:|...|
 Frog   307 AEMIIWDV--------LHKGMLKQLNVQDPIGHY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8281NP_648161.1 MADF_DNA_bdg 26..114 CDD:287510 39/91 (43%)
XB5795725XP_017945019.1 MADF_DNA_bdg 93..184 CDD:371126 39/90 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1381134at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.