DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and LSP1

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001332369.1 Gene:LSP1 / 833534 AraportID:AT5G35620 Length:198 Species:Arabidopsis thaliana


Alignment Length:192 Identity:66/192 - (34%)
Similarity:107/192 - (55%) Gaps:10/192 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NSPEPIDEEIYQVEYK---HPLEHVWTLWYLENDRTK--HWKDMLNEITEIDSVETFWSLYHTIK 98
            |.|.|...|:...|.:   |.||..|:.|: :|...|  .|...|.:....|:||.||.|:.||.
plant     7 NEPLPAAAELPATEAEKQPHKLERKWSFWF-DNQSKKGAAWGASLRKAYTFDTVEDFWGLHETIF 70

  Fly    99 TPAELKIGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSKSAKAELDQIWLDILLLMVGQNFEYSD 163
            ..::|....:..:||.|::|.|||.....||:|...|:.:.|..||:.||:.|:.::|:.|:.:|
plant    71 QTSKLTANAEIHLFKAGVEPKWEDPECANGGKWTWVVTANRKEALDKGWLETLMALIGEQFDEAD 135

  Fly   164 EICGAVINIR--NKSNKISVWTANGSNEMAILEIGQKLKILLHLQSHSLQYQLHSDA-MSKF 222
            ||||.|.::|  :|.:|:|:||...|||..::.||:|.|.:|.: :..:.:..|.|: .|:|
plant   136 EICGVVASVRPQSKQDKLSLWTRTKSNEAVLMGIGKKWKEILDV-TDKITFNNHDDSRRSRF 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 54/156 (35%)
LSP1NP_001332369.1 IF4E 27..185 CDD:396291 56/159 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.