DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and Eif4e1b

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_038952114.1 Gene:Eif4e1b / 686104 RGDID:1585494 Length:263 Species:Rattus norvegicus


Alignment Length:195 Identity:82/195 - (42%)
Similarity:131/195 - (67%) Gaps:9/195 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PEPIDEEIYQVEYKHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSVETFWSLYHTIKTPAELKI 105
            |..:..|:      |||:..|.||:.:|||::.|:|.|..:|:.|:||.||:.|..:|..::|..
  Rat    75 PTKLPREL------HPLQFRWVLWFFKNDRSRAWQDNLQLVTKFDTVEDFWATYRHVKLASKLSC 133

  Fly   106 GCDYSVFKKGIKPMWEDEANIKGGRWLVTVSKSAK-AELDQIWLDILLLMVGQNF-EYSDEICGA 168
            ||||::||:||:|||||..|.:|||||::::|..: .|||::||:.||.::|::| |||.|:|||
  Rat   134 GCDYALFKEGIQPMWEDSRNKRGGRWLLSLAKQQRHMELDRLWLETLLCLLGESFEEYSGEVCGA 198

  Fly   169 VINIRNKSNKISVWTANGSNEMAILEIGQKLKILLHLQSHS-LQYQLHSDAMSKFNSGVKSVYTL 232
            |:|||.|.:||::||:...|:..::.||...|..|.|.:.: :.||.|:|..:|.||..|:.:.:
  Rat   199 VVNIRTKGDKIALWTSEAENKAGVMHIGHIYKERLGLSTKTIIGYQAHADTAAKSNSLAKNKFVV 263

  Fly   233  232
              Rat   264  263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 69/155 (45%)
Eif4e1bXP_038952114.1 IF4E 84..243 CDD:396291 71/158 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.