DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and eif4e

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001015909.1 Gene:eif4e / 548663 XenbaseID:XB-GENE-855435 Length:214 Species:Xenopus tropicalis


Alignment Length:208 Identity:86/208 - (41%)
Similarity:136/208 - (65%) Gaps:12/208 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ESNSPEPIDEE--------IYQVEY-KHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSVETFWS 92
            |..:|:..:||        :...:| ||||::.|.||:.:||::|.|:..|..|::.|:||.||:
 Frog     7 EGTNPQSTEEEKTETSQEIVSPDQYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWA 71

  Fly    93 LYHTIKTPAELKIGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSKSAKA-ELDQIWLDILLLMVG 156
            ||:.|:..:.|..|||||:||.||:||||||.|.:|||||:|::|..:. :||:.||:.|:.::|
 Frog    72 LYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRNDLDRFWLETLMCLIG 136

  Fly   157 QNF-EYSDEICGAVINIRNKSNKISVWTANGSNEMAILEIGQKLKILLHLQSH-SLQYQLHSDAM 219
            ::| ||||::||||:|:|.|.:||::||....|..|:..||:..|..|.|.:. .:.||.|:|..
 Frog   137 ESFDEYSDDVCGAVVNVRAKGDKIAIWTTEFENRDAVTHIGKVYKERLGLPAKVVIGYQSHADTA 201

  Fly   220 SKFNSGVKSVYTL 232
            :|..|..|:.:.:
 Frog   202 TKSGSTTKNRFVV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 70/155 (45%)
eif4eNP_001015909.1 IF4E 38..194 CDD:279921 70/155 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3317
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 212 1.000 Inparanoid score I3552
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm9344
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.