DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and eif4e2

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001014815.2 Gene:eif4e2 / 541523 ZFINID:ZDB-GENE-050327-59 Length:236 Species:Danio rerio


Alignment Length:227 Identity:70/227 - (30%)
Similarity:118/227 - (51%) Gaps:27/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDIMKQQD--QQHQLNSIHKHHHHHEGVPLESNSPEPIDEEIYQVEYK--------HPLEHVWTL 63
            ||.:|..|  ...|.||..|....      |.|..|  |:|....:.|        |||::.:|.
Zfish     5 FDALKDDDSGDHDQDNSSPKDGEK------EKNDEE--DKEANTTKRKAVVPGAGEHPLQYNYTF 61

  Fly    64 WYLEND-----RTKHWKDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDE 123
            ||....     .|:.::..:.:|....|||.||..|..:..|.:|....|:.:||:||||||||:
Zfish    62 WYSRRTPGRPASTQSYEQNIKQIGSFASVEQFWRFYSHMIRPGDLTGHSDFHLFKEGIKPMWEDD 126

  Fly   124 ANIKGGRWLVTVSKSAKAELDQIWLDILLLMVGQNFEYSDEICGAVINIRNKSNKISVWTANGSN 188
            ||..||:|::.:.|...:   :.|.:::|.|:|:.|...:||||||:::|.:.:.||:|....|:
Zfish   127 ANKSGGKWIIRLRKGLAS---RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASD 188

  Fly   189 EMAILEIGQKLKILLHLQSHS-LQYQLHSDAM 219
            :.....|...|:.:|:|..:: ::|:.|:|::
Zfish   189 QATTARIRDTLRRVLNLPPNTIMEYKTHTDSI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 50/158 (32%)
eif4e2NP_001014815.2 IF4E 54..212 CDD:307672 52/160 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573584
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.