DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and eif4eb

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001007778.1 Gene:eif4eb / 493617 ZFINID:ZDB-GENE-041121-14 Length:216 Species:Danio rerio


Alignment Length:204 Identity:89/204 - (43%)
Similarity:137/204 - (67%) Gaps:7/204 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EGVPLESNSPEPIDEEIYQVEYKHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSVETFWSLYHT 96
            |.:..|||. |.:..|.|   .||||::.|.||:.:||::|.|:..|..|::.|:||.||:||:.
Zfish    17 EEISDESNQ-EIVSPESY---IKHPLQNRWCLWFFKNDKSKTWQANLRLISKFDTVEDFWALYNH 77

  Fly    97 IKTPAELKIGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSK-SAKAELDQIWLDILLLMVGQNF- 159
            |:..:.|..|||||:||.||:||||||.|.:|||||:|::| ..|.:||:.||:.||.::|:.| 
Zfish    78 IQLSSNLMSGCDYSLFKDGIEPMWEDERNKRGGRWLITLNKQQRKYDLDRFWLETLLCLIGEAFD 142

  Fly   160 EYSDEICGAVINIRNKSNKISVWTANGSNEMAILEIGQKLKILLHL-QSHSLQYQLHSDAMSKFN 223
            :|||::||||:|:|.|.:||::|||:..|..|:..||:..|..|.: .:.::.||.|:|..:|..
Zfish   143 DYSDDVCGAVVNVRTKGDKIAIWTADYGNREAVTHIGRVYKERLGVPMNMTIGYQSHADTATKSG 207

  Fly   224 SGVKSVYTL 232
            |..|:.:.:
Zfish   208 STTKNKFVV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 71/155 (46%)
eif4ebNP_001007778.1 IF4E 40..196 CDD:279921 71/155 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573566
Domainoid 1 1.000 193 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 216 1.000 Inparanoid score I3585
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm6577
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.