DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and MGC89871

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001005099.1 Gene:MGC89871 / 448677 XenbaseID:XB-GENE-973579 Length:234 Species:Xenopus tropicalis


Alignment Length:223 Identity:66/223 - (29%)
Similarity:119/223 - (53%) Gaps:18/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDIMKQQD----QQHQLNSIHKHHHHHEGVPLESNSPEPIDEEIYQVEYKHPLEHVWTLWYLEND 69
            ||.:|..|    .|::.|...|.....:. ..|.|......:.:.....:|||::.:|.||  :.
 Frog     5 FDALKDDDSGDHDQNEENGTQKDSEKEKN-EKEKNQGSSRKKSVVPGPAEHPLQYNYTFWY--SR 66

  Fly    70 RT-------KHWKDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDEANIK 127
            ||       :.::..:.:|....|||.||..|..:..|.:|....|:.:||:||||||||:||..
 Frog    67 RTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKN 131

  Fly   128 GGRWLVTVSKSAKAELDQIWLDILLLMVGQNFEYSDEICGAVINIRNKSNKISVWTANGSNEMAI 192
            ||:|::.:.|...:   :.|.:::|.|:|:.|...:||||||:::|.:.:.||:|....|::...
 Frog   132 GGKWIIRLRKGLAS---RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATT 193

  Fly   193 LEIGQKLKILLHLQSHS-LQYQLHSDAM 219
            ..|...|:.:|:|..:: ::|:.|:|::
 Frog   194 ARIRDTLRRVLNLPPNTVMEYKTHTDSI 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 51/160 (32%)
MGC89871NP_001005099.1 IF4E 55..214 CDD:366742 53/163 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.