DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and Eif4e2

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001102278.1 Gene:Eif4e2 / 363275 RGDID:1307790 Length:174 Species:Rattus norvegicus


Alignment Length:148 Identity:51/148 - (34%)
Similarity:90/148 - (60%) Gaps:6/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 TEIDS--VETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSKSAKAELD 144
            |||.:  ||.||..|..:..|.:|....|:.:||:||||||||:||..||:|::.:.|...:   
  Rat    25 TEIRARVVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLAS--- 86

  Fly   145 QIWLDILLLMVGQNFEYSDEICGAVINIRNKSNKISVWTANGSNEMAILEIGQKLKILLHLQSHS 209
            :.|.:::|.|:|:.|...:||||||:::|.:.:.||:|....|::.....|...|:.:|:|..::
  Rat    87 RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT 151

  Fly   210 -LQYQLHSDAMSKFNSGV 226
             ::|:.|:|::.....|:
  Rat   152 IMEYKTHTDSIKYVLGGL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 47/132 (36%)
Eif4e2NP_001102278.1 IF4E <32..155 CDD:279921 44/125 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.