DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and EIF4E3

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001128123.1 Gene:EIF4E3 / 317649 HGNCID:31837 Length:224 Species:Homo sapiens


Alignment Length:171 Identity:48/171 - (28%)
Similarity:86/171 - (50%) Gaps:14/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PLEHVWTLWY---LENDRTKHWKDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIK 117
            ||...||.|.   |...........|.:|..:.:|:.|||:|:.|.....|.:.|.|.:.:...:
Human    48 PLHSSWTFWLDRSLPGATAAECASNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERR 112

  Fly   118 PMWEDEANIKGGRWLVTVSKSAKAELDQIWLDILLLMVGQNF----EYSDEICGAVINIRNKSNK 178
            |:||:|:|.|||.|.:.|.|.:.:   .:|.::||..:|:.|    ...||:.|..:::|::.:.
Human   113 PLWEEESNAKGGVWKMKVPKDSTS---TVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDV 174

  Fly   179 ISVWTANGS--NEMAILEIGQKLKILLHLQSHSLQYQLHSD 217
            :.||..|.|  .|..:||  :..::|.|:...::.|:.|.:
Human   175 VQVWNVNASLVGEATVLE--KIYELLPHITFKAVFYKPHEE 213

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 44/161 (27%)
EIF4E3NP_001128123.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
IF4E 48..198 CDD:396291 44/154 (29%)