DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and eIF4E7

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster


Alignment Length:188 Identity:100/188 - (53%)
Similarity:143/188 - (76%) Gaps:2/188 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EIYQVE-YKHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYS 110
            |:.:|| .:|||.:.||||||||||.|.|::||:::|..|:||.||||...||.|:||.:|.|||
  Fly   242 ELLEVEDPQHPLNNCWTLWYLENDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYS 306

  Fly   111 VFKKGIKPMWEDEANIKGGRWLVTVSKSAKAELDQIWLDILLLMVGQNFEYSDEICGAVINIRNK 175
            :|||||:||||||||:.||||::.::||||..||..|:|.:|.::|:..::||::||.|:|||.|
  Fly   307 LFKKGIRPMWEDEANVNGGRWVINLTKSAKMALDSFWMDAMLCLIGEACKHSDDLCGVVVNIRGK 371

  Fly   176 SNKISVWTANGSNEMAILEIGQKLKILLHLQS-HSLQYQLHSDAMSKFNSGVKSVYTL 232
            |||||:|.|:|.|:..:||||:.|:.:|.:.: :.|:||||.|:..|..|.||.:||:
  Fly   372 SNKISIWNADGGNQTTVLEIGRILRKVLRMDNIYVLEYQLHKDSKDKLGSTVKRIYTV 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 83/153 (54%)
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 83/153 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470289
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm6577
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
1110.900

Return to query results.
Submit another query.