DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and Eif4e3

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001100082.1 Gene:Eif4e3 / 297481 RGDID:1586185 Length:207 Species:Rattus norvegicus


Alignment Length:195 Identity:55/195 - (28%)
Similarity:93/195 - (47%) Gaps:25/195 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GVPLESNSPEPIDEEIYQVEYKHPLEHVWTLWY---LENDRTKHWKDMLNEITEIDSVETFWSLY 94
            |..|.:..|||         ...||...||.|.   |...........|.:|..:.:|:.|||:|
  Rat    17 GKALSALQPEP---------GSIPLHSPWTFWLDRSLPGATAAECASNLKKIYTVQTVQIFWSVY 72

  Fly    95 HTIKTPAELKIGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSKSAKAELDQIWLDILLLMVGQNF 159
            :.|.....|.:.|.|.:.:...:|:||:|:|.|||.|.:.|.|.:.:   .:|.::||..:|:.|
  Rat    73 NNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTS---TVWKELLLATIGEQF 134

  Fly   160 ----EYSDEICGAVINIRNKSNKISVWTANGS--NEMAILEIGQKL-KILLHLQSHSLQYQLHSD 217
                ...|||.|..:::|::.:.:.||..|.|  .|..:||   |: ::|.|:...::.|:.|.:
  Rat   135 TDCAAADDEIIGVSVSVRDREDVVQVWNVNASLVGEATVLE---KIHQLLPHISFKAVFYKPHEE 196

  Fly   218  217
              Rat   197  196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 46/162 (28%)
Eif4e3NP_001100082.1 IF4E 34..181 CDD:279921 44/152 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334516
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.