DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and Eif4e2

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_036021474.1 Gene:Eif4e2 / 26987 MGIID:1914440 Length:265 Species:Mus musculus


Alignment Length:230 Identity:67/230 - (29%)
Similarity:118/230 - (51%) Gaps:30/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDIMKQQDQQHQLNSIHKHHHHHEGVPLESNSPEPIDEEIYQVEYK----------HPLEHVWTL 63
            ||.:|..|.       ..|..:.|....:....|..|.:..|...|          |||::.:|.
Mouse     5 FDALKDDDS-------GDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTF 62

  Fly    64 WYLENDRT-------KHWKDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWE 121
            ||  :.||       :.::..:.:|....|||.||..|..:..|.:|....|:.:||:|||||||
Mouse    63 WY--SRRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWE 125

  Fly   122 DEANIKGGRWLVTVSKSAKAELDQIWLDILLLMVGQNFEYSDEICGAVINIRNKSNKISVWTANG 186
            |:||..||:|::.:.|...:   :.|.:::|.|:|:.|...:||||||:::|.:.:.||:|....
Mouse   126 DDANKNGGKWIIRLRKGLAS---RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTA 187

  Fly   187 SNEMAILEIGQKLKILLHLQSHS-LQYQLHSDAMS 220
            |::.....|...|:.:|:|..:: ::|:.|:|:::
Mouse   188 SDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 51/160 (32%)
Eif4e2XP_036021474.1 IF4E 55..214 CDD:396291 53/163 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830816
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.