DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and tif45

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_594228.1 Gene:tif45 / 2541706 PomBaseID:SPAC16E8.15 Length:218 Species:Schizosaccharomyces pombe


Alignment Length:211 Identity:65/211 - (30%)
Similarity:109/211 - (51%) Gaps:14/211 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EGVPLESNS----PEPIDEEIYQV-------EYKHPLEHVWTLWYLENDRT-KHWKDMLNEITEI 84
            |..|.||.:    .||.::.:..|       ..||||...||||:|..... ..|.::...|...
pombe     4 EQPPKESQTENTVSEPQEKALRTVFDDKINFNLKHPLARPWTLWFLMPPTPGLEWNELQKNIITF 68

  Fly    85 DSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSKSAKAELDQIWLD 149
            :|||.||.:::.|...:.|.|..|||.|::|::|.|||..|..||:|...........||::||.
pombe    69 NSVEEFWGIHNNINPASSLPIKSDYSFFREGVRPEWEDVHNKTGGKWAFQNKGRGGNALDEMWLT 133

  Fly   150 ILLLMVGQNFE-YSDEICGAVINIRNKSNKISVWTANGSNEMAILEIGQKLKILLHL-QSHSLQY 212
            .:|..:|:..: ...|:.|.|||:|....:::|||.:.:|...::|||.:.|.:|:| :|.::::
pombe   134 TVLAAIGETLDPTGQEVMGVVINMRKGFYRLAVWTKSCNNREVLMEIGTRFKQVLNLPRSETIEF 198

  Fly   213 QLHSDAMSKFNSGVKS 228
            ..|.|:....::..|:
pombe   199 SAHEDSSKSGSTRAKT 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 51/155 (33%)
tif45NP_594228.1 CDC33 1..218 CDD:227386 65/211 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 134 1.000 Domainoid score I1275
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1318
OMA 1 1.010 - - QHG54586
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm9263
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.