DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and Eif4e1b

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001273108.1 Gene:Eif4e1b / 218268 MGIID:2685119 Length:250 Species:Mus musculus


Alignment Length:202 Identity:83/202 - (41%)
Similarity:130/202 - (64%) Gaps:18/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KHHHHHEGVPLESNSPEPIDEEIYQVEYKHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSVETF 90
            |.|..|        .||.:.:       .|||::.|.||:.:|||::.|:|.|..:|:.::||.|
Mouse    57 KAHREH--------PPEVLSK-------LHPLQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDF 106

  Fly    91 WSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSKSAK-AELDQIWLDILLLM 154
            |::|..||..::|..||||::||:||.|||||..|.:|||||:::.|..: .|||::||:.||.:
Mouse   107 WAVYSHIKLASKLSSGCDYALFKEGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCL 171

  Fly   155 VGQNF-EYSDEICGAVINIRNKSNKISVWTANGSNEMAILEIGQKLKILLHLQSHS-LQYQLHSD 217
            ||..| |||.|:||||:|||.|.:||::||:...::..:::|||..|..|.:.:.: :.||.|:|
Mouse   172 VGNCFEEYSREVCGAVVNIRTKRDKIALWTSEAEDKAGVMQIGQIYKERLGISTKTIIGYQAHAD 236

  Fly   218 AMSKFNS 224
            ..:|.|:
Mouse   237 TAAKSNN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 69/155 (45%)
Eif4e1bNP_001273108.1 IF4E 75..231 CDD:279921 69/155 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830795
Domainoid 1 1.000 186 1.000 Domainoid score I3337
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3600
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm8694
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.