DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and EIF4E

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001124151.1 Gene:EIF4E / 1977 HGNCID:3287 Length:248 Species:Homo sapiens


Alignment Length:232 Identity:86/232 - (37%)
Similarity:134/232 - (57%) Gaps:42/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ESNSPEPIDEEIYQVEY--KHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSVETFWSLYHTIKT 99
            |||      :|:...|:  ||||::.|.||:.:||::|.|:..|..|::.|:||.||:||:.|:.
Human    23 ESN------QEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQL 81

  Fly   100 PAELKIGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSK-SAKAELDQIWLDI------------- 150
            .:.|..|||||:||.||:||||||.|.:|||||:|::| ..:::||:.||:.             
Human    82 SSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETRWDLAMLPRLVSN 146

  Fly   151 ------------------LLLMVGQNF-EYSDEICGAVINIRNKSNKISVWTANGSNEMAILEIG 196
                              ||.::|::| :|||::||||:|:|.|.:||::||....|..|:..||
Human   147 FWPQVILPLQPPKVLELQLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIG 211

  Fly   197 QKLKILLHLQSH-SLQYQLHSDAMSKFNSGVKSVYTL 232
            :..|..|.|... .:.||.|:|..:|..|..|:.:.:
Human   212 RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 70/186 (38%)
EIF4ENP_001124151.1 IF4E 38..228 CDD:366742 72/189 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140841
Domainoid 1 1.000 187 1.000 Domainoid score I3336
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 214 1.000 Inparanoid score I3630
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm8454
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.