DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and ife-4

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_508210.1 Gene:ife-4 / 180464 WormBaseID:WBGene00002062 Length:212 Species:Caenorhabditis elegans


Alignment Length:183 Identity:59/183 - (32%)
Similarity:97/183 - (53%) Gaps:11/183 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HPLEHVWTLWYLENDRTK----HWKDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKG 115
            |.|::.:|..|......|    .:...:..:..:.|||.|||:....|.|.|:....|...||.|
 Worm    31 HQLQYSYTFSYFMRPTGKFDPEDYASYVQPVGIMKSVEQFWSIMVHFKRPTEMCDKADIHFFKTG 95

  Fly   116 IKPMWEDEANIKGGRWLVTVSKSAKAELDQIWLDILLLMVGQNFEYSDEICGAVINIRNKSNKIS 180
            :||:|||.||.|||:|::.:.|....   :||.::|:.::|:.|...||:||||.:|||:.:.||
 Worm    96 VKPVWEDPANCKGGKWIIRLKKGLST---RIWENLLMAIIGEQFLVGDELCGAVCSIRNQEDIIS 157

  Fly   181 VWTANGSNEMAILEIGQKLKILLHL-QSHSLQYQLHSDAM---SKFNSGVKSV 229
            :|..|..:......|.:.|:.:|.| |:..|:|:.|.|.:   |.:....|::
 Worm   158 LWNRNADDTPVTNRIRETLRSVLQLPQNTVLEYKRHDDCLRDQSSYRHTTKNI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 52/157 (33%)
ife-4NP_508210.1 IF4E 35..190 CDD:279921 52/157 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.