DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and ife-2

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_508094.1 Gene:ife-2 / 180393 WormBaseID:WBGene00002060 Length:228 Species:Caenorhabditis elegans


Alignment Length:205 Identity:82/205 - (40%)
Similarity:119/205 - (58%) Gaps:20/205 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SPEPIDEEIYQVEYKHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSVETFWSLYHTIKTPAELK 104
            :|..|...:|:      |:..||.|||.::|.|.|::.|..:....||..||:|:.:||.|:.|.
 Worm     8 APGTISHPVYK------LKRNWTWWYLNDERNKSWEERLKNVKTFSSVGEFWALHDSIKPPSGLN 66

  Fly   105 IGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSKSAKAE-LDQIWLDILLLMVGQNFEYSDEI--- 165
            ...||:||:.||:||||...|..|||||:|:.|....| :|.||.:||:.|:|:.|  ||:|   
 Worm    67 PPSDYNVFRDGIEPMWEVPQNQNGGRWLITIEKGRTPEIMDTIWTEILMAMIGEQF--SDDIESL 129

  Fly   166 CGAVINIRNKSNKISVWTANGSNEMAILEIGQKLKILLHLQS--HS------LQYQLHSDAMSKF 222
            ||.|.|:|.|.:||||||.|.:::.|.|.||..||.:|:..|  |.      |:|:.|.....|.
 Worm   130 CGIVCNVRGKGSKISVWTTNSADDGANLRIGGVLKQVLNNASMIHQRPLYDVLRYEDHESCQKKT 194

  Fly   223 NSGVKSVYTL 232
            :||||:.:.:
 Worm   195 SSGVKAKHAI 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 71/164 (43%)
ife-2NP_508094.1 IF4E 23..168 CDD:279921 67/146 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.