DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and ife-3

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_503123.1 Gene:ife-3 / 178536 WormBaseID:WBGene00002061 Length:251 Species:Caenorhabditis elegans


Alignment Length:180 Identity:83/180 - (46%)
Similarity:120/180 - (66%) Gaps:6/180 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKP 118
            :|||::.|.||||:.||.|.|:|.|..::..|:||.|||||:.|::...|..|.||.:||:||||
 Worm    31 RHPLQNRWALWYLKADRNKEWEDCLKMVSLFDTVEDFWSLYNHIQSAGGLNWGSDYYLFKEGIKP 95

  Fly   119 MWEDEANIKGGRWLVTVSKSAKAE----LDQIWLDILLLMVGQNF-EYSDEICGAVINIRNKSNK 178
            ||||..|::||||||.|.|.....    ||..||::|:.:||:.| ||.|.|||||:|:|.|.:|
 Worm    96 MWEDVNNVQGGRWLVVVDKQKLQRRTQLLDHYWLELLMAIVGEQFDEYGDYICGAVVNVRQKGDK 160

  Fly   179 ISVWTANGSNEMAILEIGQKLKILLHL-QSHSLQYQLHSDAMSKFNSGVK 227
            :|:||.:.:.:...|.|||.||..|.: .:..|:|::|.|:.::.:|.||
 Worm   161 VSLWTRDATRDDVNLRIGQVLKQKLSIPDTEILRYEVHKDSSARTSSTVK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 74/158 (47%)
ife-3NP_503123.1 IF4E 36..195 CDD:279921 74/158 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156156
Domainoid 1 1.000 173 1.000 Domainoid score I2208
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 197 1.000 Inparanoid score I2501
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - otm14399
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.