DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and ife-1

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001255196.1 Gene:ife-1 / 176755 WormBaseID:WBGene00002059 Length:231 Species:Caenorhabditis elegans


Alignment Length:211 Identity:77/211 - (36%)
Similarity:119/211 - (56%) Gaps:20/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EGVPLESNSPEPIDEEIYQVEYKHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSVETFWSLYHT 96
            ||:.....:..||          :||:..||.|||.::|.|.|:|.|.::...::|..||:||..
 Worm    18 EGMTETEQTTAPI----------YPLKRNWTWWYLNDERNKSWEDRLKKVYTFNTVSEFWALYDA 72

  Fly    97 IKTPAELKIGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSKSAKAEL-DQIWLDILLLMVGQNF- 159
            |:.|:.|...|||:||:..|:||||...|..|||||:.:.|....|: |.|||:||:.:||:.| 
 Worm    73 IRPPSGLNALCDYNVFRDDIQPMWEVPENSNGGRWLIVIDKGKTPEMVDAIWLEILMALVGEQFG 137

  Fly   160 EYSDEICGAVINIRNKSNKISVWTANGSNEMAILEIG--QKLKILLHLQSHS------LQYQLHS 216
            :..:.|||.|.|:|.|.:||||||.:.:::...:.||  .|.|::...:.||      ::|:.|.
 Worm   138 KDMESICGLVCNVRGKGSKISVWTKDCNDDETNMRIGVVLKEKLMAASKDHSKPLFDVIRYEDHE 202

  Fly   217 DAMSKFNSGVKSVYTL 232
            ....|.:|.||:..:|
 Worm   203 SCQKKTSSVVKAKLSL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 64/162 (40%)
ife-1NP_001255196.1 IF4E 37..181 CDD:279921 61/143 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.