DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and Eif4e

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_446426.1 Gene:Eif4e / 117045 RGDID:69647 Length:217 Species:Rattus norvegicus


Alignment Length:207 Identity:86/207 - (41%)
Similarity:136/207 - (65%) Gaps:12/207 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SNSPEPIDE-------EIYQVEY--KHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSVETFWSL 93
            :.:|.|.:|       |:...|:  ||||::.|.||:.:||::|.|:..|..|::.|:||.||:|
  Rat    11 TTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWAL 75

  Fly    94 YHTIKTPAELKIGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSK-SAKAELDQIWLDILLLMVGQ 157
            |:.|:..:.|..|||||:||.||:||||||.|.:|||||:|::| ..:::||:.||:.||.::|:
  Rat    76 YNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGE 140

  Fly   158 NF-EYSDEICGAVINIRNKSNKISVWTANGSNEMAILEIGQKLKILLHLQSH-SLQYQLHSDAMS 220
            :| :|||::||||:|:|.|.:||::||....|..|:..||:..|..|.|... .:.||.|:|..:
  Rat   141 SFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTAT 205

  Fly   221 KFNSGVKSVYTL 232
            |..|..|:.:.:
  Rat   206 KSGSTTKNRFVV 217

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 70/155 (45%)
Eif4eNP_446426.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 3/15 (20%)
EIF4EBP1/2/3 binding. /evidence=ECO:0000250|UniProtKB:P06730 37..40 2/2 (100%)
IF4E 38..197 CDD:396291 72/158 (46%)