DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E5 and eif4e1b

DIOPT Version :9

Sequence 1:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_002936991.4 Gene:eif4e1b / 100127761 XenbaseID:XB-GENE-6258261 Length:217 Species:Xenopus tropicalis


Alignment Length:213 Identity:87/213 - (40%)
Similarity:132/213 - (61%) Gaps:12/213 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EGVPLESNSPEPIDEE---------IYQVEYKHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSV 87
            |.:.::....|.:|.|         |.:...||.|:..|.||:.:|.:::.|:..|..:|..::|
 Frog     5 EAISIKELPREKLDNEKRRKKKESVILEKVIKHSLQSRWALWFFKNVKSQPWQCNLRLVTTFNTV 69

  Fly    88 ETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSKSAK-AELDQIWLDIL 151
            |.|||||..|:..::|..|||||:||.||:|||||..|.:|||||:|:||..: ::||.:||:.|
 Frog    70 EDFWSLYTHIQLASKLSSGCDYSLFKDGIEPMWEDSRNKRGGRWLITLSKQQRHSDLDALWLETL 134

  Fly   152 LLMVGQNF-EYSDEICGAVINIRNKSNKISVWTANGSNEMAILEIGQKLKILLHLQSH-SLQYQL 214
            |.::|:.| |||:|:||||||||.|.:||::||....|..|:..||:..|..|.|.|. .:.||.
 Frog   135 LCLIGEAFDEYSEEVCGAVINIRAKGDKIAIWTRETENREAVTHIGKVYKERLGLSSKVVIGYQA 199

  Fly   215 HSDAMSKFNSGVKSVYTL 232
            |:|..:|.:|..|:.:.:
 Frog   200 HADTATKSSSLSKNKFVV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 72/155 (46%)
eif4e1bXP_002936991.4 IF4E 39..197 CDD:396291 73/157 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3317
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3552
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm9344
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.