DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32365 and vat1

DIOPT Version :10

Sequence 1:NP_729304.1 Gene:CG32365 / 38876 FlyBaseID:FBgn0052365 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001007052.3 Gene:vat1 / 368752 ZFINID:ZDB-GENE-030616-178 Length:484 Species:Danio rerio


Alignment Length:71 Identity:15/71 - (21%)
Similarity:26/71 - (36%) Gaps:13/71 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PTNEAKLQQQQQQQQLENQESLERDNEQDSPCATPPPALPARRHTANMIHFGASNQLLTAQPPHP 124
            |..:...::|:||:.....||.:.:::.|     |||...:..        .|:.....|..|.|
Zfish     7 PAQQQNAEEQKQQETKTPAESPKTESKPD-----PPPTSASTE--------AAATAAAAADTPAP 58

  Fly   125 PQHPQP 130
            .....|
Zfish    59 AAEKAP 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32365NP_729304.1 None
vat1NP_001007052.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..65 15/71 (21%)
MDR3 72..409 CDD:176236
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..484
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.