DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32369 and RAD18

DIOPT Version :9

Sequence 1:NP_001246660.1 Gene:CG32369 / 38873 FlyBaseID:FBgn0052369 Length:1066 Species:Drosophila melanogaster
Sequence 2:NP_009992.1 Gene:RAD18 / 850430 SGDID:S000000662 Length:487 Species:Saccharomyces cerevisiae


Alignment Length:413 Identity:89/413 - (21%)
Similarity:141/413 - (34%) Gaps:151/413 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   679 QLIDASDFD---------------CVVCSRTLWKPVVTPCGHTYCLVCLDRCMDYNSPCPLCM-- 726
            |:..||||.               |.:|...|..||:||||||:|.:|:...::....||||:  
Yeast     4 QITTASDFTTTSIPSLYQLDTLLRCHICKDFLKVPVLTPCGHTFCSLCIRTHLNNQPNCPLCLFE 68

  Fly   727 ------------SPLVE-FNVNASASTSASQHPNP-------------NQNQIHLHPGSSSPVPF 765
                        |.::: :....|:...|.:.|.|             |.:.|.|...|.|....
Yeast    69 FRESLLRSEFLVSEIIQSYTSLRSSLLDALRIPKPTPVPENEEVPGPENSSWIELISESESDSVN 133

  Fly   766 A--------------LAKRPVTKFLEAAMKRFIPDHYE-ARFRQEIDQEPSVPVFICTAAFPAVP 815
            |              ||||.:|..|..:.|   |.... |.||.|..::.|.|      ......
Yeast   134 AADDDLQIVATSERKLAKRSMTDILPLSSK---PSKRNFAMFRSERIKKKSKP------NEQMAQ 189

  Fly   816 CPLFVCEPRYRLMVRRAVESGDKTFGIVQPNGGKSRYYDVGTILDIRDCV---QLGDGCSILSTI 877
            ||  :|:..|.|   :|:|.                     |.||  :|:   .||....|.:|.
Yeast   190 CP--ICQQFYPL---KALEK---------------------THLD--ECLTLQSLGKKPKISTTF 226

  Fly   878 ---------GCKRFKILARNEKDGYETAKVEYICDEPIADEQVKILAGMQGVVLAKASEWFESLS 933
                     ...|||: ...|.|.....:..::      |:.:..:...:...|.|.:  |.|::
Yeast   227 PTESNPHNKSSSRFKV-RTPEVDKSSCGETSHV------DKYLNSMMSAEHQRLPKIN--FTSMT 282

  Fly   934 TEQKHEILQSFG--------QMPPLEPNWELISDGPAWAW---WIIALLPLSQQLKVDILATTSL 987
            ..|..:.|.|.|        .|.....::|::       |   :..:|.|:.:         ..|
Yeast   283 QSQIKQKLSSLGLSTNGTRQNMIKRYNHYEML-------WNSNFCDSLEPVDE---------AEL 331

  Fly   988 EKRLRAIDKTLDWLHDLSHPQQP 1010
            :::|      |.|  |:||.:.|
Yeast   332 KRQL------LSW--DVSHNKTP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32369NP_001246660.1 RING 183..>206 CDD:302633
TPR_11 349..412 CDD:290150
TPR repeat 350..378 CDD:276809
TPR_11 383..449 CDD:290150
TPR repeat 383..413 CDD:276809
RING 687..729 CDD:238093 18/70 (26%)
LON 791..1005 CDD:271862 44/236 (19%)
LON_substr_bdg 802..1001 CDD:280370 38/221 (17%)
RAD18NP_009992.1 RAD18 1..470 CDD:227719 89/413 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2251
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.