powered by:
Protein Alignment CG32369 and Rnf168
DIOPT Version :9
Sequence 1: | NP_001246660.1 |
Gene: | CG32369 / 38873 |
FlyBaseID: | FBgn0052369 |
Length: | 1066 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001121069.2 |
Gene: | Rnf168 / 690043 |
RGDID: | 1585168 |
Length: | 566 |
Species: | Rattus norvegicus |
Alignment Length: | 63 |
Identity: | 20/63 - (31%) |
Similarity: | 32/63 - (50%) |
Gaps: | 2/63 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 166 LRVPSPLQDLEDFDPLMCPLCSDILRCPVTTNCGHTFCRQCCE-TITQCNICQVRFPRIQASS 227
:::.:|...:.......|.:|.:||..|||..|.||.|..|.: |:.:.|:| ..|.|.:.||
Rat 1 MKMAAPKNSIPSLAECQCGICMEILVEPVTLPCNHTLCNPCFQSTVEKANLC-CPFCRRRVSS 62
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2802 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D458276at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.