DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32369 and Rnf168

DIOPT Version :9

Sequence 1:NP_001246660.1 Gene:CG32369 / 38873 FlyBaseID:FBgn0052369 Length:1066 Species:Drosophila melanogaster
Sequence 2:NP_001121069.2 Gene:Rnf168 / 690043 RGDID:1585168 Length:566 Species:Rattus norvegicus


Alignment Length:63 Identity:20/63 - (31%)
Similarity:32/63 - (50%) Gaps:2/63 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 LRVPSPLQDLEDFDPLMCPLCSDILRCPVTTNCGHTFCRQCCE-TITQCNICQVRFPRIQASS 227
            :::.:|...:.......|.:|.:||..|||..|.||.|..|.: |:.:.|:| ..|.|.:.||
  Rat     1 MKMAAPKNSIPSLAECQCGICMEILVEPVTLPCNHTLCNPCFQSTVEKANLC-CPFCRRRVSS 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32369NP_001246660.1 RING 183..>206 CDD:302633 11/22 (50%)
TPR_11 349..412 CDD:290150
TPR repeat 350..378 CDD:276809
TPR_11 383..449 CDD:290150
TPR repeat 383..413 CDD:276809
RING 687..729 CDD:238093
LON 791..1005 CDD:271862
LON_substr_bdg 802..1001 CDD:280370
Rnf168NP_001121069.2 RING 17..60 CDD:238093 17/43 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D458276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.