DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32369 and SPAC6B12.07c

DIOPT Version :9

Sequence 1:NP_001246660.1 Gene:CG32369 / 38873 FlyBaseID:FBgn0052369 Length:1066 Species:Drosophila melanogaster
Sequence 2:NP_593762.2 Gene:SPAC6B12.07c / 2543315 PomBaseID:SPAC6B12.07c Length:470 Species:Schizosaccharomyces pombe


Alignment Length:274 Identity:56/274 - (20%)
Similarity:94/274 - (34%) Gaps:124/274 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 DMEEEVEVEVEGGEPGSLHLDGDF---------------------LFPSALDFMDHHRHQRHVFE 593
            ||.|...:|:      ||:.|.:|                     || :|:|.:.|         
pombe   165 DMSEVQSMEI------SLNCDHEFFEKLTSELQSVEGLQREQRKILF-NAIDILSH--------- 213

  Fly   594 QKQFDLQPRRHANRK----HCKRK-WSVAMESMGGKD--LEEEDVDRAH---------------- 635
              :..|....::.:|    :|.|| :.:.|:|    |  :..::.|::|                
pombe   214 --EISLIASPNSKKKYKSLYCWRKIFEIYMDS----DIFISCKEADQSHERTPELAERHLKWFDD 272

  Fly   636 --------AAGESQRCSRLFAGVLDRTQ--------QELQRL------KKLDKSAPSLAVSSVAG 678
                    .:....|...|:|..|:..:        |::.:|      ||.||.. ||....:..
pombe   273 QVRLAKCLPSSSKHRDRILYAKFLELNESLLKVASFQQMNKLAVTKIMKKFDKRT-SLTAQPLFF 336

  Fly   679 QLIDAS----------------------------DFDCVVCSRTLWKPVVTPCGHTYCLVCL--- 712
            |:|::.                            ||:|.:||...:|||...|.|.:||.||   
pombe   337 QVIESDPLLLVDNASKAICFSLSSKLFSIIPQLRDFECAICSNVAYKPVRLGCSHVFCLHCLIIL 401

  Fly   713 -DRCMDYNSPCPLC 725
             .:.:|:   ||||
pombe   402 QKQKVDF---CPLC 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32369NP_001246660.1 RING 183..>206 CDD:302633
TPR_11 349..412 CDD:290150
TPR repeat 350..378 CDD:276809
TPR_11 383..449 CDD:290150
TPR repeat 383..413 CDD:276809
RING 687..729 CDD:238093 17/43 (40%)
LON 791..1005 CDD:271862
LON_substr_bdg 802..1001 CDD:280370
SPAC6B12.07cNP_593762.2 SPX 2..>48 CDD:269894
PEX10 69..428 CDD:227861 56/274 (20%)
SPX <254..325 CDD:269894 9/70 (13%)
RING 373..415 CDD:238093 17/43 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.