DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32369 and T02C1.1

DIOPT Version :10

Sequence 1:NP_729296.1 Gene:CG32369 / 38873 FlyBaseID:FBgn0052369 Length:1066 Species:Drosophila melanogaster
Sequence 2:NP_499044.1 Gene:T02C1.1 / 176305 WormBaseID:WBGene00011365 Length:160 Species:Caenorhabditis elegans


Alignment Length:41 Identity:17/41 - (41%)
Similarity:24/41 - (58%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   685 DFDCVVCSRTLWKPVVTPCGHTYCLVCLDRCMDYNSPCPLC 725
            ||.|.||.....:|.:..|||:||..|::..::.|..||||
 Worm     5 DFCCAVCLDFFVEPCIIECGHSYCRFCIESHLNINEKCPLC 45

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32369NP_729296.1 RING_Ubox 179..222 CDD:473075
TPR repeat 350..378 CDD:276809
TPR 357..>438 CDD:440225
Spy 363..>517 CDD:443119
TPR repeat 383..413 CDD:276809
RING-HC_LONFs_rpt2 685..729 CDD:438177 17/41 (41%)
LON/PUA 811..999 CDD:442054
T02C1.1NP_499044.1 rad18 3..>69 CDD:273165 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.