DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32369 and LOC102557137

DIOPT Version :9

Sequence 1:NP_001246660.1 Gene:CG32369 / 38873 FlyBaseID:FBgn0052369 Length:1066 Species:Drosophila melanogaster
Sequence 2:XP_038956438.1 Gene:LOC102557137 / 102557137 RGDID:7505527 Length:351 Species:Rattus norvegicus


Alignment Length:413 Identity:76/413 - (18%)
Similarity:134/413 - (32%) Gaps:127/413 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   664 LDKSAPSLAVSSVAGQLIDASDFDCVVCSRTLWKPVVTPCGHTYCLVCLDRCM-DYNSPCPLCMS 727
            |.|:.|           :...|..|::|...|.:|:..||.||.|..|....: ..|..||.|.|
  Rat     3 LSKAKP-----------LSLEDCQCLLCMEFLIEPITMPCNHTMCKSCFKALLRKTNLFCPFCRS 56

  Fly   728 PLVEF-----NVNASASTS-----ASQHP------NPNQNQIHLHPGSSSPV-----PFAL---- 767
            .:..:     :||:..:..     .:|:|      .|.:.:..|.....||:     |..|    
  Rat    57 WISSWARYHTHVNSLINKELWERIQTQYPEECRRRTPGEERSSLVFSDHSPIRVLSNPGELRKEY 121

  Fly   768 --------AKRPVTK---------FLEAAMKRFIPDH---YEARFRQEIDQEPSVPVFICTAAFP 812
                    |:|..||         :::..:.:.:.:.   .|.|..:|.:|.........:.:.|
  Rat   122 EEQLIKMEAERQATKERQNRATEEYIKQLLAKELEEEKMWAEKRRLEEREQREEEEAKKSSTSDP 186

  Fly   813 AVPCPLFVCEPRYRLMVRRAVESGDKTFGIVQPNGGKSRYYDVGTILDIRDCVQLGDGCSILSTI 877
                   |..||.:...|:..:...| |...||....:..|:  |:.|.:            .|.
  Rat   187 -------VTSPRKKKSKRKHCDDVPK-FSPHQPQLESALLYE--TVQDSK------------KTS 229

  Fly   878 GCKRFKILARNEKDGYETAKVEYICDEPIADEQVKILAGMQGVVLAKASEWFESLSTEQKHEILQ 942
            |.|             :.||.|               ..|....|:...|..:..::..::|:..
  Rat   230 GRK-------------QEAKTE---------------ENMSAATLSTGPENPQQGTSNSRYEVFS 266

  Fly   943 SF----GQMPPLEPNWELISDGPAWAWWIIALLPLSQQLKVDILATTS-----LEKRLRAIDKTL 998
            ::    |......|.....:        |...:| |:.:|.:....||     :.|.....:.|:
  Rat   267 NYDAKVGSSEDEAPKASCSN--------IDCYVP-SKNIKPEANIHTSAQRETMSKTEETGNSTI 322

  Fly   999 DWLHDLSHPQQPAHHPMNHHQQA 1021
            :....:|||......|  |:|:|
  Rat   323 EAKEKMSHPSSGITRP--HYQKA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32369NP_001246660.1 RING 183..>206 CDD:302633
TPR_11 349..412 CDD:290150
TPR repeat 350..378 CDD:276809
TPR_11 383..449 CDD:290150
TPR repeat 383..413 CDD:276809
RING 687..729 CDD:238093 15/42 (36%)
LON 791..1005 CDD:271862 35/222 (16%)
LON_substr_bdg 802..1001 CDD:280370 32/207 (15%)
LOC102557137XP_038956438.1 RING_Ubox 16..55 CDD:418438 13/38 (34%)
RING-HC finger (C3HC4-type) 16..54 CDD:319361 13/37 (35%)
UDM1_RNF168 111..>160 CDD:409018 6/48 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D458276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.