DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32369 and rnf168

DIOPT Version :9

Sequence 1:NP_001246660.1 Gene:CG32369 / 38873 FlyBaseID:FBgn0052369 Length:1066 Species:Drosophila melanogaster
Sequence 2:XP_012825502.1 Gene:rnf168 / 100144920 XenbaseID:XB-GENE-5765249 Length:542 Species:Xenopus tropicalis


Alignment Length:523 Identity:101/523 - (19%)
Similarity:179/523 - (34%) Gaps:123/523 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 RVPSPLQDLEDFDPLMCPLCSDILRCPVTTNCGHTFCRQCCE-TITQCNICQVRFPRIQASSPGP 230
            ::|.|      :...:||:|.:||..|||..|.||.|..|.: |:.:.::|             .
 Frog    14 KLPLP------WSECICPICQEILLEPVTLPCKHTLCNPCFQMTVEKASLC-------------C 59

  Fly   231 PVCALTTTTASGAGSSLFTAPSNHNANLSLISFPVGYGV--QLSSSVQRLA----APPMTVTTTT 289
            |.|....:|.:          ..|:...:|::..:...:  |.....||.|    :..::...|:
 Frog    60 PFCRKRVSTWA----------RQHSRTRTLVNKELWEVIQKQYPKQCQRRASGQESDDLSDELTS 114

  Fly   290 VASTTATATTTMASTSAAAALGLSAYPSAHGGGIGSTAMKFMPDVLVRRLVEKWWGPDLQAKKIS 354
            ...........:.....|....:.|..:|........:..::..:|.....|:....:...::|.
 Frog   115 CPVPVLCKPGEIRQEYEAEVSKIEAERTAQEEAERKASEDYIQKLLAEEEAEENLHAEASQREIE 179

  Fly   355 EKASSCMHL-NLLDDALKFCNASLEK-SPANFKSLCLRAEVLLKLSHYQSSLADIENALRTRCTS 417
            |:......| .||...:...|||... ||...|.:..::..::|..  |....|||     |..|
 Frog   180 EQLKRDEELARLLSGDMDLSNASCTSVSPVTSKKVVSKSSKIVKSK--QRVSGDIE-----RFLS 237

  Fly   418 PKAHYLRALALSGLGRLEEALYNGFLAICLDKKTNLSNSEIFQHDLA------KILQRLLAHMPK 476
            ||..  ||||..|:.....:..:| ..|.||:..:  ..||  .||:      .::|.....:| 
 Frog   238 PKPR--RALAAFGINESRNSDTSG-SCILLDEDED--EDEI--PDLSPQCPSTSLIQERDVELP- 294

  Fly   477 NRTSLSSATVPVFQQQHRNFATSRAPY-PLLWEQVRRRRKQQHHHHHHHHHHHVHLDDVEDEFGH 540
                                    .|| |..::.......||              |...:....
 Frog   295 ------------------------MPYLPNCYKLESDAASQQ--------------DSCSERNDI 321

  Fly   541 YNNYIMAGDDMEEEVEVEVEGGEPGSLHLDGDFLFPSALDFMDHHRHQRHVFEQKQFDLQPRRHA 605
            .|......|.::.||...:|.....:...:    :....:.|.:...:|.. |:...|::.:..:
 Frog   322 CNGTYSCSDSIDVEVSKTMEQQRATADSQE----YRMETNAMSYSTPKRKC-EECYLDIEEKAGS 381

  Fly   606 NRKHCKRKWSVAMES-----MGGK--DLEEEDVDRAHAAGESQRCSRLFAGVLDRTQQELQRLKK 663
            .:...|:|.|::.:|     ..||  :|||...:|.    :.:...||||         ||..::
 Frog   382 CQSVKKKKLSLSEDSPVLSVHAGKFIELEENLYERR----KQEEHDRLFA---------LQLQRE 433

  Fly   664 LDK 666
            |||
 Frog   434 LDK 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32369NP_001246660.1 RING 183..>206 CDD:302633 12/22 (55%)
TPR_11 349..412 CDD:290150 16/64 (25%)
TPR repeat 350..378 CDD:276809 8/28 (29%)
TPR_11 383..449 CDD:290150 18/65 (28%)
TPR repeat 383..413 CDD:276809 6/29 (21%)
RING 687..729 CDD:238093
LON 791..1005 CDD:271862
LON_substr_bdg 802..1001 CDD:280370
rnf168XP_012825502.1 RING-HC_RNF168 24..65 CDD:319464 17/53 (32%)
RING-HC finger (C3HC4-type) 24..62 CDD:319464 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D458276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.