DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and AT1G53540

DIOPT Version :10

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_175759.1 Gene:AT1G53540 / 841789 AraportID:AT1G53540 Length:157 Species:Arabidopsis thaliana


Alignment Length:149 Identity:28/149 - (18%)
Similarity:62/149 - (41%) Gaps:26/149 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALVPATNNTDWDYWDYRRRLWRDWDLNDWDLPYWKRSLSRVGSAP--DLSRVIVGKDGFEANVD 63
            |:|:|:.      :...|..::..:.|:.:|......:.|.:.:||  |::.....|..:....:
plant     1 MSLIPSI------FGGRRTNVFDPFSLDVFDPFEGFLTPSGLANAPAMDVAAFTNAKVDWRETPE 59

  Fly    64 VHLFK-------PYEISVKTSGDTVVV---------EAKHEKRRDGDTFVGRHIVKRFVLPRGYY 112
            .|:||       ..|:.|:.....::.         |.|::|....:...|: ..:||.||....
plant    60 AHVFKADLPGLRKEEVKVEVEDGNILQISGERSNENEEKNDKWHRVERSSGK-FTRRFRLPENAK 123

  Fly   113 PNDVRSELSSDGILTVKCP 131
            ..::::.: .:|:|:|..|
plant   124 MEEIKASM-ENGVLSVTVP 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 17/92 (18%)
AT1G53540NP_175759.1 ACD_ScHsp26_like 51..142 CDD:107229 18/93 (19%)

Return to query results.
Submit another query.