DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and AT1G07400

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_172220.1 Gene:AT1G07400 / 837252 AraportID:AT1G07400 Length:157 Species:Arabidopsis thaliana


Alignment Length:166 Identity:44/166 - (26%)
Similarity:75/166 - (45%) Gaps:34/166 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALVPATNNTDWDYWDYRRR---LWRDWDLNDWDLPY----WKRSLSRVGSAPDLSRVIVGKDGF 58
            |:|:|:       ::...||   ::..:.|:.|| |:    :..|||...||...:|| ..|:..
plant     1 MSLIPS-------FFGNNRRSNSIFDPFSLDVWD-PFKELQFPSSLSGETSAITNARV-DWKETA 56

  Fly    59 EANV---DVHLFKPYEISVKTSGDTVVV---EAKHEKRRDGDTFVGRHIVKR--------FVLPR 109
            ||:|   |:...|..|:.|:...|:|:.   |...||....||:   |.|:|        |.||.
plant    57 EAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTW---HRVERSSGQFSRKFKLPE 118

  Fly   110 GYYPNDVRSELSSDGILTVKCPPYLTNERSVYVRQV 145
            ....:.|::.: .:|:|||..|.....::...|:.:
plant   119 NVKMDQVKASM-ENGVLTVTVPKVEEAKKKAQVKSI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 26/90 (29%)
AT1G07400NP_172220.1 ACD_ScHsp26_like 49..140 CDD:107229 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.