DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and AT5G51440

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_199957.1 Gene:AT5G51440 / 835218 AraportID:AT5G51440 Length:210 Species:Arabidopsis thaliana


Alignment Length:122 Identity:26/122 - (21%)
Similarity:47/122 - (38%) Gaps:33/122 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RDWDLNDWDLPYWKRSLSRVGSAPDLSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVV--EA 85
            |.|::.:.|                        |.....:|:......::.:....:|:|:  |.
plant   109 RGWNVKEKD------------------------DALHLRIDMPGLSREDVKLALEQNTLVIRGEG 149

  Fly    86 KHEKRRD--GDTFVGRHIVKRFVLPRGYYPND-VRSELSSDGILTVKCPPYLTNERS 139
            :.|:..|  ||   ||....|..||...|..| :::|: .:|:|.|..|....:||:
plant   150 ETEEGEDVSGD---GRRFTSRIELPEKVYKTDEIKAEM-KNGVLKVVIPKIKEDERN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 20/81 (25%)
AT5G51440NP_199957.1 ACD_sHsps-like 112..195 CDD:107221 21/110 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.