DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and AT5G37670

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_198583.1 Gene:AT5G37670 / 833746 AraportID:AT5G37670 Length:137 Species:Arabidopsis thaliana


Alignment Length:131 Identity:31/131 - (23%)
Similarity:52/131 - (39%) Gaps:36/131 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WKRSLSRVGSAPDLSRVIVGKDGFEANVDVHLFK-------PYEISVKTS--------GDTVVVE 84
            |.||.:.:             |..|:| :.|:||       ..:|.|:..        |:.:..|
plant    17 WSRSTALI-------------DWMESN-NSHIFKINVPGYNKEDIKVQIEEGNVLSIRGEGIKEE 67

  Fly    85 AK-----HEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCPPYLTNERSVYVRQ 144
            .|     |...|:..:..|...::|..||.....:.|::.: .:|:|||..|.. |:.:|..||.
plant    68 KKENLVWHVAEREAFSGGGSEFLRRIELPENVKVDQVKAYV-ENGVLTVVVPKD-TSSKSSKVRN 130

  Fly   145 V 145
            |
plant   131 V 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 22/96 (23%)
AT5G37670NP_198583.1 ACD_ScHsp26_like 24..119 CDD:107229 22/109 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.