DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and ATHSP22.0

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_192763.1 Gene:ATHSP22.0 / 826616 AraportID:AT4G10250 Length:195 Species:Arabidopsis thaliana


Alignment Length:108 Identity:28/108 - (25%)
Similarity:49/108 - (45%) Gaps:21/108 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DGFEANVDVHLFKPYEISVKTSGDTVV---VEAKHEKRRDGDTFVGRHIVKR--------FVLPR 109
            :|.|..:|:...|..|:.::...:.|:   .|.|.|:.:.||.:   |.|:|        |.||.
plant    80 EGHEIMLDIPGLKKDEVKIEVEENGVLRVSGERKREEEKKGDQW---HRVERSYGKFWRQFKLPD 141

  Fly   110 GYYPNDVRSELSSDGILTVKCPPYLTNERSVYVRQVGPSYLSI 152
            ......|:::| .:|:||:.    ||......|:  ||..::|
plant   142 NVDMESVKAKL-ENGVLTIN----LTKLSPEKVK--GPRVVNI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 22/85 (26%)
ATHSP22.0NP_192763.1 IbpA 42..177 CDD:223149 27/106 (25%)
ACD_ScHsp26_like 72..163 CDD:107229 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.