DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and AT2G29500

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_180511.1 Gene:AT2G29500 / 817499 AraportID:AT2G29500 Length:153 Species:Arabidopsis thaliana


Alignment Length:163 Identity:41/163 - (25%)
Similarity:71/163 - (43%) Gaps:30/163 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALVPATNNTDWDYWDYRRRLWRDWDLNDWDLPY---WKRSLSRVGSAPDLSRVIVGKDGFEANV 62
            |:::|:..|.     :.|..::..:.|:.|| |:   ...||||..||     ::..:..:....
plant     1 MSMIPSFFNN-----NRRSNIFDPFSLDVWD-PFKELTSSSLSRENSA-----IVNARVDWRETP 54

  Fly    63 DVHLF-------KPYEISVKTSGDTVVV---EAKHEKRRDGDTF--VGR---HIVKRFVLPRGYY 112
            :.|:|       |..|:.|:...|:|:.   |...||....||:  |.|   ...:||.||....
plant    55 EAHVFKADLPGLKKEEVKVEIEEDSVLKISGERHVEKEDKNDTWHRVERSSGQFTRRFRLPENVK 119

  Fly   113 PNDVRSELSSDGILTVKCPPYLTNERSVYVRQV 145
            .:.|::.: .:|:|||..|...|.:..|...|:
plant   120 MDQVKAAM-ENGVLTVTVPKAETKKADVKSIQI 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 23/91 (25%)
AT2G29500NP_180511.1 ACD_ScHsp26_like 47..138 CDD:107229 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.