DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and hspb11

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001092897.1 Gene:hspb11 / 796767 ZFINID:ZDB-GENE-030131-5148 Length:205 Species:Danio rerio


Alignment Length:97 Identity:28/97 - (28%)
Similarity:48/97 - (49%) Gaps:10/97 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VGKDG--FEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGD----TFVGRHIVKRFVLPRGY 111
            :||:|  :...:|...|.|.|::||..|..:.|..|.||::|..    ::..:...:.|.||.|.
Zfish    80 LGKEGSHYALTLDTQDFSPEELAVKQVGRKLRVSGKTEKKQDDGKGSYSYRCQEFRQEFDLPEGV 144

  Fly   112 YPNDVRSELSSDGILTVKCP---PYLTNERSV 140
            .|..|...| ::|.|.::.|   ..::|||.:
Zfish   145 NPESVSCSL-NNGQLQIQAPREGNTVSNERVI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 24/82 (29%)
hspb11NP_001092897.1 IbpA 36..177 CDD:223149 28/97 (29%)
ACD_HspB9_like 81..164 CDD:107236 24/83 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..205
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.