DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and Hspb3

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_113938.1 Gene:Hspb3 / 78951 RGDID:68345 Length:152 Species:Rattus norvegicus


Alignment Length:76 Identity:25/76 - (32%)
Similarity:42/76 - (55%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRS 118
            ||..|:..:||..|.|.:|.::|....::::|:|..|.|...|:.|...:::.||.|....|:.:
  Rat    69 GKSRFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVETKDLSA 133

  Fly   119 ELSSDGILTVK 129
            .|..||||.|:
  Rat   134 ILCHDGILVVE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 25/76 (33%)
Hspb3NP_113938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..69 25/76 (33%)
ACD_HspB3_Like 65..147 CDD:107232 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.