DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and hspb1

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001072817.1 Gene:hspb1 / 780278 XenbaseID:XB-GENE-480320 Length:211 Species:Xenopus tropicalis


Alignment Length:133 Identity:40/133 - (30%)
Similarity:61/133 - (45%) Gaps:24/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WRDWDLNDW-----------------------DLPYWKRSLSRVGSAPDLSRVIVGKDGFEANVD 63
            |..|....|                       ..|.:.|:|||..|: .:|.:....|.::.::|
 Frog    43 WYQWPSTSWPGYVRMLPSQSMEVVPPTTPAGATAPDFNRALSRQLSS-GISEIRQTSDQWKISLD 106

  Fly    64 VHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTV 128
            |:.|.|.|:.:||....|.:..|||:::|...|:.|...:::.||.|...|.|.|.||.||||||
 Frog   107 VNHFAPEELVIKTKDGIVEITGKHEEKQDEHGFISRCFTRKYTLPPGVDINKVASSLSPDGILTV 171

  Fly   129 KCP 131
            :.|
 Frog   172 EAP 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 29/76 (38%)
hspb1NP_001072817.1 ACD_HspB1_like 90..175 CDD:107230 31/85 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.